PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024602-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 171aa    MW: 18799 Da    PI: 6.7876
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024602-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.57e-5724118195
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                    vreqdr+lPianvsrimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plkvyl++yre ++
  NNU_024602-RA  24 VREQDRYLPIANVSRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLNRYREGDT 118
                    69*****************************************************************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.6E-5419129IPR009072Histone-fold
SuperFamilySSF471135.12E-4027135IPR009072Histone-fold
PfamPF008083.0E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-207795No hitNo description
PRINTSPR006151.1E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MADAPASPGG GSHESGEQSP RSNVREQDRY LPIANVSRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKVYL NRYREGDTKG  120
SAKSVDKKDG VGIQQVSNPQ ITHQGSYTQG VNYMNSQSQG QHLMLPMQGS D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B8e-4923115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-4923115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244998.11e-125PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ8VYK42e-81NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLS6DEZ21e-105S6DEZ2_CUCSA; Nuclear transcription factor Y subunit B-8-like
STRINGGLYMA03G33490.12e-97(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-82nuclear factor Y, subunit B8